[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67867.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->73 2axuC PDBj 1e-04 18.5 %
:RPS:SCOP  10->74 1perL  a.35.1.2 * 6e-04 21.1 %
:HMM:PFM   34->72 PF01381 * HTH_3 6.1e-05 35.1 37/55  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67867.1 GT:GENE BAC67867.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(179949..180287) GB:FROM 179949 GB:TO 180287 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67867.1 LENGTH 112 SQ:AASEQ MTAKLDYRWKLREVMATRGMFSTISLQPLLAERGIDLSSSQVYRLVTERPERLSLKVLMALLDILDCSMDDLIEPVASASSAAKPKRAVGDADTSVGSFRPKRARIVPRSEP GT:EXON 1|1-112:0| SEG 77->83|asassaa| RP:PDB:NREP 1 RP:PDB:REP 10->73|2axuC|1e-04|18.5|54/295| HM:PFM:NREP 1 HM:PFM:REP 34->72|PF01381|6.1e-05|35.1|37/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 10->74|1perL|6e-04|21.1|57/63|a.35.1.2| OP:NHOMO 17 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------1----------------111--2---12---1---1--2------2----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 61.6 SQ:SECSTR HHHHHHHHHHHHHHHHHTTcc####cHHHHHTT#HTTcHHHHHHHHcTTTccccHHHHHHHHHHHTccHHHHHc###################################### DISOP:02AL 1-3, 85-98, 104-105, 107-112| PSIPRED ccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccHHEEEEEccccccccHHHHHHHHHHHcccHHHHHHcccccccccccccHHHccccccccccccEEEEcccccc //