[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67869.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   91->143 PF09214 * Prd1-P2 0.00059 28.3 53/560  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67869.1 GT:GENE BAC67869.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 181802..182389 GB:FROM 181802 GB:TO 182389 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67869.1 LENGTH 195 SQ:AASEQ MLYLATPSGADVRAAMQAGLLACMTTPAQGNVIPPGALYACDNGKFGKGWPGEQAWFAWLTATVNRYSRGRCLWAVAPDVPMDAAATLAESLPWLEPIRALGIPAAFAAQDGSEHGLIPWDSIDVLFLAGSTEWKTSPAAHRLAVEARKRGLAVHMGRVNSRRRLRIAQAFGCTSCDGTYLAFGPDTNLPASWPG GT:EXON 1|1-195:0| SEG 75->86|avapdvpmdaaa| HM:PFM:NREP 1 HM:PFM:REP 91->143|PF09214|0.00059|28.3|53/560|Prd1-P2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 4-7| PSIPRED cEEEEcccccHHHHHHHHHHHEEEcccccccccccccEEEEccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHcHHHHHHHcccccEEEEEEccccccccccccEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccEEEEcccccccccccc //