[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67870.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 71->162 ADEC_METB6 1e-04 38.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67870.1 GT:GENE BAC67870.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 182430..182948 GB:FROM 182430 GB:TO 182948 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67870.1 LENGTH 172 SQ:AASEQ MTTRLRHIGAAIMGILDPIPSTVPSPMREEEGAWVRAHAWTKGLRKIEDAYPCGFHRWCSCERGICPGCASGHHDRCVSAGGPRVDEHADTITDAQGFVVAVIRFRPGQRPCRWICPCPHPTAVEETAETGKPEKPPAAQHAVPAQRPAVAPEGQLPLFASGPQEHGDGEAP GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 71->162|ADEC_METB6|1e-04|38.0|92/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 126-141, 161-172| PSIPRED cccHHHHHHHHHHHHHHHcccccccccHHccccEEEHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccccHHHHHHcccccEEEEEEEEcccccccEEEccccccHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccc //