[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67872.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->58 PF00324 * AA_permease 0.00021 16.7 54/479  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67872.1 GT:GENE BAC67872.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 184316..184795 GB:FROM 184316 GB:TO 184795 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67872.1 LENGTH 159 SQ:AASEQ MKIRRILTWLAATAATTALILFGASPASATVYWQTYSTNSNWHCGPTTKTPLSNYVVFQTCIVVTPDKTKGQAVLIVTNSSTKDVILRQGEVHSDELYGVNGYSTCTYDYTLSSGQSRACFGPTVAFSTCGDGYAWGVLHANSFDYAMGTETVRFVTTC GT:EXON 1|1-159:0| TM:NTM 1 TM:REGION 6->28| SEG 6->21|iltwlaataattalil| HM:PFM:NREP 1 HM:PFM:REP 5->58|PF00324|0.00021|16.7|54/479|AA_permease| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHEEEEEEEcccccEEEEEEEEcccccEEEccccccccccEEEEEEEEEEccccccccEEEEEEcccccEEEEEcccccccEEEcccccEEEEEEEEEccccccEEEccEEEEEcccccEEEEEEEcccccccccccEEEEEEEc //