[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67873.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->47 PF03777 * DUF320 0.00022 38.2 34/60  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67873.1 GT:GENE BAC67873.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(185138..185368) GB:FROM 185138 GB:TO 185368 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67873.1 LENGTH 76 SQ:AASEQ MSRAKWVRTRCRHGSGSSPSAQRPVRCPVYVAGGCGHVVRAGAAACGPGRLPSTVRAPSRYRILCPYVRVRPAETP GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 14->47|PF03777|0.00022|38.2|34/60|DUF320| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 8-24, 73-76| PSIPRED ccccHHHHHHHcccccccccccccccccEEEEccccHHHHccccccccccccccccccccEEEEcccEEEEccccc //