[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67876.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67876.1 GT:GENE BAC67876.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 187026..187742 GB:FROM 187026 GB:TO 187742 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67876.1 LENGTH 238 SQ:AASEQ MTSRREPRLADAAEIAAEQGLTPSRISQFYTERAENAAGRTFPDPVDKRGRARLWNHAEVTEWFADRAPSRLAEHAPPSLPPGTLLNAAEASRYLGYKNSSQVTTFVRDHPGYFPEPDVVEEKGTAANPYRRQLWKVETLQAWMATRPGRGRRAGAKEAPPLPDVPVDGDPEELLGASQAAALLGYKTVGSFSSSLSQGNLPLLKTTDGVAENAGRQNGRRRWTRRRILEQAAQRSKK GT:EXON 1|1-238:0| SEG 147->185|rpgrgrragakeapplpdvpvdgdpeellgasqaaallg| SEG 216->227|rqngrrrwtrrr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 149-160, 213-219, 231-238| PSIPRED ccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //