[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67877.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:304 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  20->141 1yg2A_ a.4.5.61 * 0.00026 17.4 %
:HMM:PFM   25->86 PF02002 * TFIIE_alpha 0.0002 16.7 60/105  
:HMM:PFM   217->260 PF00025 * Arf 0.00071 29.5 44/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67877.1 GT:GENE BAC67877.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 188180..189094 GB:FROM 188180 GB:TO 189094 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67877.1 LENGTH 304 SQ:AASEQ MNSAAQSIPATAMAPTPAEPLTHQVLAGLAQHRIATTSQMRRMLRPDGTRQLMSRVLNRLRSDGFVDCTVLPDANRTRTNAWYLTQEGARLTRDLPVLRGRPPYPISSMTAASLKTPHTLAVVRAHLAFAADARRLGHEHGPWDWTPEVSHSIGEGERIVADAVMYYTVVESEHRRKLRAFVEVDRSTMSSERLAVKLIEYARLFQYEAQPVGRRRQASVGPAWLRWYPVFPRVLFVLTGASRVRLENRMSDLQAMVAQHPLVAGLAREVRLGAAVLEDLEQHGPAQDVWMPLVGGNSRPWTDL GT:EXON 1|1-304:0| SEG 9->22|patamaptpaeplt| HM:PFM:NREP 2 HM:PFM:REP 25->86|PF02002|0.0002|16.7|60/105|TFIIE_alpha| HM:PFM:REP 217->260|PF00025|0.00071|29.5|44/175|Arf| HM:SCP:REP 20->141|1yg2A_|0.00026|17.4|121/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------41------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21, 107-111, 210-218, 298-304| PSIPRED cccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEccHHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccEEccccEEEEEEccccHHHHHHHHEEEccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccccccccccc //