[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67882.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->73 PF06081 * DUF939 0.00026 23.5 51/141  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67882.1 GT:GENE BAC67882.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 194571..194891 GB:FROM 194571 GB:TO 194891 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67882.1 LENGTH 106 SQ:AASEQ MLAGRLDETGDGWINMLESWATKGFKAGLMALVVIGMVQKFSLKAGLGALLLMVIALGLYDSRNDLADMFTDEVKNPSKGAPAVPGIVRGPDPLARVHSDGTGDGL GT:EXON 1|1-106:0| TM:NTM 2 TM:REGION 18->40| TM:REGION 44->66| HM:PFM:NREP 1 HM:PFM:REP 21->73|PF06081|0.00026|23.5|51/141|DUF939| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 100-106| PSIPRED cccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccHHHHHccccccccc //