[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67883.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67883.1 GT:GENE BAC67883.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 194888..195463 GB:FROM 194888 GB:TO 195463 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67883.1 LENGTH 191 SQ:AASEQ MSAATMGRVGRFYTSARRHPWVLGKVADWKIPLGPYTPAQIAVAVGGGFLLVKTISWWSWMGPVPIVAWVLTVWAVRRPKIKGRAPLQAALGWVLLAWQPQGGRMGGRAARDRLSRPLFGGFTLEVAAPAVPVMATLRVDQPAADRKARRGPAVRPSARPRSAPQARPVSVGPVSGVQQLLALAEQAGGAR GT:EXON 1|1-191:0| TM:NTM 3 TM:REGION 37->57| TM:REGION 63->76| TM:REGION 84->100| SEG 102->113|ggrmggraardr| SEG 176->190|gvqqllalaeqagga| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 140-170, 188-191| PSIPRED ccccHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccHHHccEEEEEcccccccccEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccc //