[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67885.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->112 PF09594 * DUF2029 0.00018 21.4 98/241  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67885.1 GT:GENE BAC67885.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 198138..198488 GB:FROM 198138 GB:TO 198488 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67885.1 LENGTH 116 SQ:AASEQ MTSFAPSRSRRLAAAASALTVIAVAVGVLVLALGVSLPEAWWPRTGQAFAADAAKAPADPCDRIAGPAKAYCERGRHATSAQAGGDAAAWKLLSAATAIGALVIWRRRAHTRQGRA GT:EXON 1|1-116:0| TM:NTM 1 TM:REGION 15->37| SEG 5->35|apsrsrrlaaaasaltviavavgvlvlalgv| SEG 48->60|afaadaakapadp| SEG 78->98|atsaqaggdaaawkllsaata| HM:PFM:NREP 1 HM:PFM:REP 9->112|PF09594|0.00018|21.4|98/241|DUF2029| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 111-116| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccHHHHHcccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //