[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67887.1
DDBJ      :             putative NLP/P60-family secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  404/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.118.1d.2.1d.3.1
:383 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   279->365 2k1gA PDBj 1e-08 39.2 %
:RPS:PDB   133->262 1d0lA PDBj 1e-06 15.9 %
:RPS:SCOP  147->227 1bpoA1  a.118.1.4 * 8e-05 5.0 %
:RPS:SCOP  244->374 2evrA2  d.3.1.16 * 4e-21 34.6 %
:HMM:SCOP  16->225 1qusA_ d.2.1.6 * 1.5e-29 32.0 %
:HMM:SCOP  229->383 2evrA2 d.3.1.16 * 1.4e-31 40.6 %
:RPS:PFM   273->365 PF00877 * NLPC_P60 2e-13 53.5 %
:HMM:PFM   253->368 PF00877 * NLPC_P60 2e-24 50.6 87/105  
:HMM:PFM   82->223 PF01464 * SLT 9e-06 26.0 100/121  
:BLT:SWISS 187->362 YDDH_BACSU 5e-19 43.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67887.1 GT:GENE BAC67887.1 GT:PRODUCT putative NLP/P60-family secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 201219..202370 GB:FROM 201219 GB:TO 202370 GB:DIRECTION + GB:PRODUCT putative NLP/P60-family secreted protein GB:NOTE Seems to have a cleavable N-term signal sequence, PF00877: NlpC/P60 family GB:PROTEIN_ID BAC67887.1 LENGTH 383 SQ:AASEQ MRTARRRKTQWGCVVVLLLFAAVCCAAPAGNAISAYVALKTGASADGGVAEGGTAADIPPRMLTAYKKAVQQVGKHVPKCQGMRWPILAGIAKVESNHAVGRNIADNGDIRPRIYGVLLNGSGAGGNTTAFPDTDGGKWDGTASGERAVGPFQFLPSTWEGIGEDANGDKTADPHNADDAALGAAAYLCGNGRDLTKRAQLKAAILQYNHSNEYVSNVLGWIDQYTAAAKDPDLKNVTGKVRTVIEAALSQRGVPYSWGGGNASGRSYGICCSPSGKSGASIKGFDCSGLTLYAYAKAGIQLPRTAAAQAGVGQRIPTSLGSDALNAGDLVFYADAPGHDSTIYHVGIYVGSGQMVNAARPGTVVRLDAVNAMSGYAGGARLL GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 187->362|YDDH_BACSU|5e-19|43.2|148/329| TM:NTM 1 TM:REGION 17->39| SEG 13->27|cvvvlllfaavccaa| SEG 177->186|addaalgaaa| BL:PDB:NREP 1 BL:PDB:REP 279->365|2k1gA|1e-08|39.2|79/129| RP:PDB:NREP 1 RP:PDB:REP 133->262|1d0lA|1e-06|15.9|126/314| RP:PFM:NREP 1 RP:PFM:REP 273->365|PF00877|2e-13|53.5|86/100|NLPC_P60| HM:PFM:NREP 2 HM:PFM:REP 253->368|PF00877|2e-24|50.6|87/105|NLPC_P60| HM:PFM:REP 82->223|PF01464|9e-06|26.0|100/121|SLT| RP:SCP:NREP 2 RP:SCP:REP 147->227|1bpoA1|8e-05|5.0|80/157|a.118.1.4| RP:SCP:REP 244->374|2evrA2|4e-21|34.6|104/148|d.3.1.16| HM:SCP:REP 16->225|1qusA_|1.5e-29|32.0|206/322|d.2.1.6|1/1|Lysozyme-like| HM:SCP:REP 229->383|2evrA2|1.4e-31|40.6|128/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 1002 OP:NHOMOORG 410 OP:PATTERN -------------------------------------------------------------------- --12945555544476666-6N4467777776DAEFABBH544I522141-1-22111224351878CEB7---------212-2111--1------------1--1------------------1--11--11--11111---2---------------------------------------12-----323121221111121122311133211434332-4333344211----------1-------2454222-111222222311-111111------------111-11-1--------------11---2-1-1115633345642523B11121-12112-12-154-21---121-11---1-1----------------------------------------------------------------------------------------------------------------------------21112222222222222222222222222-21--12211--2211112---1--1-112222222-----1--------2312221122111111------1------1111---1-----------222-1----------------1-------------1---1------21-11112222222122-222222222122122222111111---111111111111111111121112--111111111111-------------1--1------1-------------------1-22222223222221222------------------------22212112222222----------------------------------------------------------- --------------------111---1-----------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 60.3 SQ:SECSTR ####################################################################################################################################HTTccTTTcEEcTTcccTTTTccHHHHHHHcccTTccccccTTcHHHHHHHHHHHH####HHTTccTTcccEEEEEcccccccccTTccEHHHHHHTTcEEccccTTccEEEEEEEEccccEEEEEEcHH################cccTTcccHHHHHHHHHHHTcccccccHHHHGGGcEEEcGGEcGGGccTTEEEEEEETHEccTTEEEEEEEEETTEEEEEETTTEEEEcccTTHHHHEEEEEEcc DISOP:02AL 1-6, 34-54| PSIPRED ccccHHccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHEEEEEEEccccccccccHHHcccccHHcHHHcccccccHHHEEEccccccccccccHHHHcccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHcccccccccHHHccccEEEEEcccccccccccEEEEEEcccEEEEEcccccEEEEEEccccccccEEEEEc //