[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67890.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->90 2b0lA PDBj 1e-04 15.5 %
:RPS:PDB   110->213 1c0aA PDBj 9e-04 14.1 %
:RPS:SCOP  24->91 3bz6A2  a.4.5.75 * 2e-05 16.2 %
:HMM:SCOP  17->96 2fbkA1 a.4.5.28 * 2.1e-05 28.2 %
:HMM:PFM   23->67 PF03965 * Pencillinase_R 3.5e-06 26.7 45/115  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67890.1 GT:GENE BAC67890.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 205611..206525 GB:FROM 205611 GB:TO 206525 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC67890.1 LENGTH 304 SQ:AASEQ MTTAFETLSSGRTPSPVEPLPHQLLAVLGQHRMATTGQLHDLLRPDAARQTVSTPLNKLRRKGLVDYAVLPQSNRSRAWYLTGEGARLVRDFPALRGRPPYPITSATAASLKTPHTLTVVRTHLAFVTDARRRGDEHGHLDWTPEVSHPLSDGEKIITDAVMHYTLIGDDQRTKLRAFVEVDRTTMSSERLASKLIEYARLWSYEPQPASRSRARQPAVPGAVWLRWYPVFPRVLFALTGASRYVLDNRISDLQAMVAQHPLVGTLARQVPMGAAVLEDLEDKGPTRNVWVPLAGGKPRPWTEL GT:EXON 1|1-304:0| RP:PDB:NREP 2 RP:PDB:REP 18->90|2b0lA|1e-04|15.5|71/98| RP:PDB:REP 110->213|1c0aA|9e-04|14.1|99/585| HM:PFM:NREP 1 HM:PFM:REP 23->67|PF03965|3.5e-06|26.7|45/115|Pencillinase_R| RP:SCP:NREP 1 RP:SCP:REP 24->91|3bz6A2|2e-05|16.2|68/84|a.4.5.75| HM:SCP:REP 17->96|2fbkA1|2.1e-05|28.2|78/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------41------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 55.9 SQ:SECSTR #################HHHHHHTTcccTTEEEEcHHHHHHHH##TccHHHHHHHHHHHHHTTcEEEEEcccccEEEEEccHHHHHHHHH###################HTTcHHHHHHHHHHHHHHHHHHHHHHHTTcE####EcccccccccccccccccEEEccccTTcEEcccccHHH#HHHHHHTTccEEEEEEEEEccccccTTccc########################################################################################### DISOP:02AL 1-18, 104-108, 210-217, 301-304| PSIPRED ccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEccHHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccEEcccHHcccHHccHHHEEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //