[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67891.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.3
:286 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  172->250 1b4rA  b.1.3.1 * 5e-04 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67891.1 GT:GENE BAC67891.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 207837..208697 GB:FROM 207837 GB:TO 208697 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67891.1 LENGTH 286 SQ:AASEQ MDGHGVDRERSSLLTRRLSLLIGALVLAAAGTAHADDDPDVGAGKCQVIKFCVGVGVDDETGGKGTQTGSQGSSGSKTQCKLTKVNPKPPANHPVWNGADPKKSDLYFRACTDGGDGFVVVPQGQPAPQVDPQELAQRAVDSMTLLGPDIASPRGAGKYTVGVPTWMWVNQSATTFGPNTASASAGGITVTATAKVSKIVWQMGDGASVTCNGPGTPYQASEGMAQSPNCGHVYSKSSAGARSGKYPVTATSTWTIDWQGGGAAGQLTEIRQTNVQVAIGELQVVR GT:EXON 1|1-286:0| SEG 10->35|rsslltrrlslligalvlaaagtaha| SEG 61->79|tggkgtqtgsqgssgsktq| SEG 119->133|vvvpqgqpapqvdpq| RP:SCP:NREP 1 RP:SCP:REP 172->250|1b4rA|5e-04|28.3|60/80|b.1.3.1| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----3--------------------------------1----11-1--------------111----12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 60-79| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEEEEEcccccccccccccccccccEEEEEEEcccccccccccccccccccccEEEEEccccccccEEcccccccccccHHHHHHHHHHcEEEcccEEEcccccccccccccEEEEEccccEEEEEEEEEEEcccEEEEEccEEEEEEEEccccccEEcccccccccccccccccccccEEEEccccccccccEEEEEEEEEEEEEEcccccccEEEcccccEEEEEEEEEEEc //