[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67892.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.85.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   66->127 1ameA PDBj 9e-06 15.5 %
:RPS:SCOP  65->127 1xuuA1  b.85.1.1 * 3e-06 22.0 %
:HMM:PFM   66->127 PF08666 * SAF 3.4e-11 27.9 61/63  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67892.1 GT:GENE BAC67892.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 208719..209423 GB:FROM 208719 GB:TO 209423 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01354: Antifreeze-like domain GB:PROTEIN_ID BAC67892.1 LENGTH 234 SQ:AASEQ MSKSQERLAASPNGVPQQGRVSGAVAPPRVSARRRRPGVIALSLALIAAGGAGVAVLLLQVGHRTEVVTVARDVQVGQVLSEEDLGKASIALDPAVKAVRAGDLDSVVGKRAAVELRPGSLLAPSQVTEDSLVKAGEQLVPIGLKSEQVPATALVPGQKVELVHVPAQGVEDTGKSSGLSPRTIAGRVVKASGAAPGSGVVVVDVATSADDGPIAAAWVSAGTLRLVLAAPDGS GT:EXON 1|1-234:0| TM:NTM 1 TM:REGION 39->61| SEG 23->62|gavapprvsarrrrpgvialslaliaaggagvavlllqvg| SEG 188->212|vvkasgaapgsgvvvvdvatsaddg| RP:PDB:NREP 1 RP:PDB:REP 66->127|1ameA|9e-06|15.5|58/66| HM:PFM:NREP 1 HM:PFM:REP 66->127|PF08666|3.4e-11|27.9|61/63|SAF| RP:SCP:NREP 1 RP:SCP:REP 65->127|1xuuA1|3e-06|22.0|59/68|b.85.1.1| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------111------------1-------1121---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 25.2 SQ:SECSTR #################################################################cEEEEcccccTTccccGGGEE###EEEccccccccGGGHHHHTTcEEcccccTTccccGGGE########################################################################################################### DISOP:02AL 1-19, 171-175, 233-234| PSIPRED cccccHHHccccccccccccccEEEccccHHHHHccccEEHHHHHHHHHcccHHHHHHHHcccccEEEEEEEcccccHHHHcccccEEEEEccccccccccccHHHEEEEEEEEEcccccEEccccccccccccccHHHHcEEEEEccccccccccccEEEEEEcccccccccccccccccEEEEEEEEEcccccccccEEEEEEEEEcccHHHHHHHHHcccEEEEEEccccc //