[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67893.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:275 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->180 3b6rA PDBj 1e-06 10.4 %
:RPS:SCOP  1->217 1cp2A  c.37.1.10 * 3e-06 17.5 %
:HMM:SCOP  1->258 1ionA_ c.37.1.10 * 1.5e-09 25.8 %
:RPS:PFM   1->48 PF06564 * YhjQ 8e-04 41.3 %
:BLT:SWISS 77->141 FH18_ORYSJ 8e-04 35.4 %
:BLT:SWISS 133->214 DNLJ_SYNP2 1e-05 40.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67893.1 GT:GENE BAC67893.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 209423..210250 GB:FROM 209423 GB:TO 210250 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01656: CobQ/CobB/MinD/ParA nucleotide binding domain GB:PROTEIN_ID BAC67893.1 LENGTH 275 SQ:AASEQ MAVIALAGCSGAPGVTTSALALLLSWPLEQGRKMILAECDPDGGAVLHGLLQGTLGDRYGLRNLSVAARKGESGDAFWRQLIDLSSDDGKQESPRDRLLLPGITDPAQAASLVSVWKALAVAFRGIDASQGHDILIDLGRTGAFGPSAVLAEQADAVVVVVRNTLRSLQSAQARVAVLEKRVGDVGLIVINEGPYPAGEVQRVLQVPVVATLPYAPKDAQVLSDGADQPRHFTKSALMKASRTCSALLVQRAAARRARLDPRAAFVGGGEVTRAR GT:EXON 1|1-275:0| BL:SWS:NREP 2 BL:SWS:REP 77->141|FH18_ORYSJ|8e-04|35.4|65/906| BL:SWS:REP 133->214|DNLJ_SYNP2|1e-05|40.8|76/678| SEG 246->264|allvqraaarrarldpraa| RP:PDB:NREP 1 RP:PDB:REP 3->180|3b6rA|1e-06|10.4|164/376| RP:PFM:NREP 1 RP:PFM:REP 1->48|PF06564|8e-04|41.3|46/242|YhjQ| RP:SCP:NREP 1 RP:SCP:REP 1->217|1cp2A|3e-06|17.5|200/269|c.37.1.10| HM:SCP:REP 1->258|1ionA_|1.5e-09|25.8|236/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------111--------------------1111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 226 STR:RPRED 82.2 SQ:SECSTR cETccHHHHHHHHHHHHHHHTTccGGGcEEEEEcTTccHHHHHHcHHHHTHHHTTccccccccHHHHTTTTTTTTTTTcEEEEEETTEEEEETTccEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHTTccccEETTTEEccccGGccTccEEEEEEEcHHHHTcTTHHHHHHHcccccccEEETTTTcccccHHHHHHccccEEccccHHHHHHHHHTG################################################# DISOP:02AL 239-257, 273-275| PSIPRED cEEEEEEcccccccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHcccccccccHHHEEHHHHccccHHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHcccEEEEccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHEEccccEEccc //