[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67895.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   128->219 3c1qB PDBj 5e-05 11.8 %
:HMM:PFM   114->237 PF00482 * GSPII_F 1.1e-13 22.9 118/124  
:HMM:PFM   43->77 PF06072 * Herpes_US9 0.00045 40.0 35/60  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67895.1 GT:GENE BAC67895.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 211730..212659 GB:FROM 211730 GB:TO 212659 GB:DIRECTION + GB:PRODUCT putative integral membrane protein GB:NOTE PF00482: Bacterial type II secretion system protein F domain GB:PROTEIN_ID BAC67895.1 LENGTH 309 SQ:AASEQ MTLLWGLLSGMAVIGGLIGVVAGLVGTTAPRRAPLQQRWQALRAGKDQGEDVRLRRRTLAALAVVVFVAVWLVSGNFVGGALLGVAVVGVPWLISPAQMAQERIGQLEALSEWTQRLAGLLRLGMGLEQAMITSRQGAPDELAPQIVNLSDRLRLGWRPDGALRAFAEELNDVTADKVVAALILSVNDRGPGLAQALEDLAGTVRDEVAKKRAIEADRAKPRTTVRWMTVITVGVVVAGFFVPSYTKPYSTLLGQLVLAFLTVGFIGVLALMRQLGAFRRIPRFLITDPSSTVRLPLAGDGAGRAGRWP GT:EXON 1|1-309:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 67->89| TM:REGION 224->245| TM:REGION 252->274| SEG 12->26|aviggligvvaglvg| SEG 52->73|vrlrrrtlaalavvvfvavwlv| SEG 78->90|vggallgvavvgv| SEG 116->127|rlagllrlgmgl| RP:PDB:NREP 1 RP:PDB:REP 128->219|3c1qB|5e-05|11.8|85/112| HM:PFM:NREP 2 HM:PFM:REP 114->237|PF00482|1.1e-13|22.9|118/124|GSPII_F| HM:PFM:REP 43->77|PF06072|0.00045|40.0|35/60|Herpes_US9| OP:NHOMO 14 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ----3--------------------------------111----1-----1---------112----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 27.5 SQ:SECSTR ###############################################################################################################################HHHHHHHHHTcccHHHHHHHHHHHHHHTTccHHHHHTTcTTTccHHHH#######HHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHH########################################################################################## DISOP:02AL 217-218, 304-309| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccEEEEEcccccccccccc //