[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67897.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->67 PF05808 * Podoplanin 0.00024 21.1 57/162  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67897.1 GT:GENE BAC67897.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 213608..213823 GB:FROM 213608 GB:TO 213823 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67897.1 LENGTH 71 SQ:AASEQ MKHTAARTYRAVHWATTRLQEGLEEAKRRPDRGDISTTTVIIWVAAVTGAVLIAGTIAVVISKYNGKLTGL GT:EXON 1|1-71:0| TM:NTM 1 TM:REGION 42->64| SEG 35->51|istttviiwvaavtgav| HM:PFM:NREP 1 HM:PFM:REP 11->67|PF05808|0.00024|21.1|57/162|Podoplanin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 22-32| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccc //