Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67911.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67911.1 GT:GENE BAC67911.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(237840..238601) GB:FROM 237840 GB:TO 238601 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67911.1 LENGTH 253 SQ:AASEQ MVGGQWRGVVERLAQQLGEAQAAGRRVKEAKATAARQSPSSTGLERAEYQRRLRAYVQTPEHKAAGHAIRVAVALMKAHDAALLRSAHTLLARRANGKRPPRRLPRPLVLPGGYASQWWISSIDSTYAGIWRAIPSPGPELRLGSTNDPLVQEVAKQARLLQASHVGYRGRDDLYEAFHPDGTREGGEPVAPIRGLSQETSRRANLALGRGNGIRIQPSRMEEAGQMHTDYFAVWDRSRAYAAAVLALLRARA GT:EXON 1|1-253:0| SEG 11->26|erlaqqlgeaqaagrr| SEG 99->111|rpprrlprplvlp| SEG 239->252|rayaaavlallrar| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 20-47, 97-99| PSIPRED ccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccHHHHHHHcEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //