[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67917.1
DDBJ      :             putative IstB-like ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  220/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.26.1c.37.1
:167 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   16->116 2z4rA PDBj 1e-07 29.0 %
:RPS:PDB   1->153 3eccA PDBj 5e-07 15.9 %
:RPS:SCOP  5->116 1exzA  a.26.1.2 * 8e-16 10.2 %
:HMM:SCOP  10->139 1l8qA2 c.37.1.20 * 1.4e-19 30.8 %
:RPS:PFM   2->125 PF01695 * IstB 6e-18 37.1 %
:HMM:PFM   2->140 PF01695 * IstB 1.7e-47 41.7 139/178  
:BLT:SWISS 2->164 ISTB_BACST 6e-25 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67917.1 GT:GENE BAC67917.1 GT:PRODUCT putative IstB-like ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(242908..243411) GB:FROM 242908 GB:TO 243411 GB:DIRECTION - GB:PRODUCT putative IstB-like ATP-binding protein GB:NOTE PF01695: IstB-like ATP binding protein GB:PROTEIN_ID BAC67917.1 LENGTH 167 SQ:AASEQ MIHTLAKCEWIKKSLPLCLIGDSGTGKSHLLIALGTEAAMAGYRVKYVLATKLVNELVEAADEKQLTKTIARYGRVDLLCIDELGYMELDRRGAELLFQVLTEREEKNSVAIASNESFSGWTKTFTDPRLCAAIVDRLTFGGNIIETGTDSYRLATTRARAEQQAVV GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 2->164|ISTB_BACST|6e-25|35.6|163/251| BL:PDB:NREP 1 BL:PDB:REP 16->116|2z4rA|1e-07|29.0|100/240| RP:PDB:NREP 1 RP:PDB:REP 1->153|3eccA|5e-07|15.9|151/182| RP:PFM:NREP 1 RP:PFM:REP 2->125|PF01695|6e-18|37.1|124/145|IstB| HM:PFM:NREP 1 HM:PFM:REP 2->140|PF01695|1.7e-47|41.7|139/178|IstB| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01695|IPR002611| RP:SCP:NREP 1 RP:SCP:REP 5->116|1exzA|8e-16|10.2|98/133|a.26.1.2| HM:SCP:REP 10->139|1l8qA2|1.4e-19|30.8|130/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1278 OP:NHOMOORG 223 OP:PATTERN --------------------------------------------------I-2--------------- 3-512--6-------4-11-12---222222-1--1-92----1---1---32-4-1---7-2---7231-4---4A----2-------3-4-6-----------1----------------------5Q4-1-------------J-------------------1-----------------1------31-----------1---6-3--------11----1----------------------------------------22----------7--------------------------------------------6B2-1--------------------8--9-1--2-3527--15---7---1--8--3------28-272--6-------------2-339---11-2--11166-J1--53--------1B--1--22222222CC8-----------------------62-----------1F4-----1-556--C----ED65-------BF---4--2-413-9--53161-4I-1--------------K----5--4-2-3-------3B824154-124322-------------------------35-B21Q----1--a--1-3-1--2---1-------11-----------------6-4A-9-------1--21-----------2--------1-1--1-----1111123--M---lcZ5*WmQ-6-----------3-1--4--------1------------------4---1----1-----8O4-----------------------------1-----------2------------------------------------5-------C2--------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 91.6 SQ:SECSTR HHHHHHHTccTTcccEEEEEEcTTccHHHHHHHHHHHHHHHTccccEEEEHHHHHHHHHHTccccHHHHHHHTcccEEEETTTcccccccHHHHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHHHHHEEEEEccccccc############## PSIPRED cHHHHHccHHHHccccEEEEccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHccccHHHHHHHHccccEEEEccHHHccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHccccHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHccc //