[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67920.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->95 PF01925 * TauE 0.00072 15.1 53/239  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67920.1 GT:GENE BAC67920.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(246027..246653) GB:FROM 246027 GB:TO 246653 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67920.1 LENGTH 208 SQ:AASEQ MREGCSARGALTHLHLHRDSDEPYEPGVEMSPSSSSRKKRRRLIVSAVTANGAGAVAGVAAQAAISDPFFSALVAAFVAGVVGDLLLQVTRTRNGALGDAARPGEHGRAGRRELDNGHGGDDRAARHKTGDGNGRASGARPGCTRCTRPSRQDAHPAAPRVSPSEAVMTPRHLYHRHLHRGAKRFTRRVHERNARHGLRQPRGTHGAS GT:EXON 1|1-208:0| SEG 33->42|ssssrkkrrr| SEG 47->64|avtangagavagvaaqaa| SEG 72->87|alvaafvagvvgdlll| HM:PFM:NREP 1 HM:PFM:REP 42->95|PF01925|0.00072|15.1|53/239|TauE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 25-43, 99-138, 150-160, 195-208| PSIPRED cccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //