[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67929.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.117.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->248 1aiqA PDBj 4e-20 23.7 %
:RPS:SCOP  86->248 1aiqA  d.117.1.1 * 2e-05 20.3 %
:HMM:SCOP  94->246 1qzfA2 d.117.1.1 * 0.00022 20.9 %
:HMM:PFM   110->246 PF00303 * Thymidylat_synt 4.4e-08 21.4 117/266  
:BLT:SWISS 128->248 TYSY_METKA 4e-06 31.4 %
:PROS 1->11|PS00626|RCC1_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67929.1 GT:GENE BAC67929.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 256598..257401 GB:FROM 256598 GB:TO 257401 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67929.1 LENGTH 267 SQ:AASEQ MSGGLMHTFTVTERDVTQAWVAACNKLDRKDNPDRTGLHTVVRIADPTSDDPVFRAELDRLRTARGLWPLETVASTLFPAALAARSADPDDLAERYRRMYPVIKRYPGNHRGTYFGRLVFYPAASKTGIDQLSTVISRLRTQAAGTKIAAAYEIDIAAATDQEEAGADLLVHTAGKDNSYIGFPCLSHISLQLDRDRRVHAAALYRSHFMFERAYGNYLGLGRLLAYIAQQAELACGTLTVMAGHARLDGPVTQLRPLLTGTSRLAA GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 128->248|TYSY_METKA|4e-06|31.4|102/209| PROS 1->11|PS00626|RCC1_2|PDOC00544| SEG 148->159|iaaayeidiaaa| RP:PDB:NREP 1 RP:PDB:REP 33->248|1aiqA|4e-20|23.7|177/263| HM:PFM:NREP 1 HM:PFM:REP 110->246|PF00303|4.4e-08|21.4|117/266|Thymidylat_synt| RP:SCP:NREP 1 RP:SCP:REP 86->248|1aiqA|2e-05|20.3|138/265|d.117.1.1| HM:SCP:REP 94->246|1qzfA2|0.00022|20.9|134/341|d.117.1.1|1/1|Thymidylate synthase/dCMP hydroxymethylase| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 88.4 SQ:SECSTR ############################cccTccTTcccEEEEEEETTTcccccccccccHHHHHHHHHHcccccccHHHHHTHTcccTHHHHHTTccTTGGGcGGGccTTccHHHHHHHEEcTTccEEcHHHHHHHHHHHcTTccccEEEcccTcccTccTTTGGGcccccccGGGGGGcccccEEEEEEEEEETTEEEEEEEEEEEETTTTHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEEETTcHHHHHHHTTcccc### DISOP:02AL 1-4, 266-267| PSIPRED ccccEEEEEEEcHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccccHHccHHHHHHccccccccccccHHHHHEEEEEcccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHEEEHHHcccccHHHEEHHHHcHHHHcc //