[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67930.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  7/199 : Viruses  1/175   --->[See Alignment]
:343 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67930.1 GT:GENE BAC67930.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(257443..258474) GB:FROM 257443 GB:TO 258474 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67930.1 LENGTH 343 SQ:AASEQ MVTVLQERAEQRVLDCGPARKIRVAGRTLTVTPVFDTYWRFAAARQKVYEARLAGGAGPFTDDPILQRHRFTNCFRAADRVSQDLIGGVIYRGEQAWEEVFFRTLLFKIFNKTSTWRLLNGALGEVRWNAYDYRTYDRVLSQAFSAGQRLYSAAYIVPPPQLGEERKHQNHLRLLEMMMTADAPQRVLSAPTLEGAYRVLLGFPAIGPFLAYQFVIDLNYAAEMPFSEMDFVVPGPGARDGIRKCFGSAADGIEAEVIRYMADTQDEHFARLGLSFAGLRGRPLQLIDCQNLFCEVDKYARVAHPDIAGISGRSRIKQTYRQQADAMPAWFPPKWQLNGPPGH GT:EXON 1|1-343:0| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- --------------------------------------1----------------------------1---------------------------------------------------------1----------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1--------------------------------1---------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------121-111------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------ DISOP:02AL 4-7, 312-314, 316-319, 339-343| PSIPRED cccHHHHHHHHHHHccccccEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHcHHHHHHEEEcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHccHHHccccccccEEEccccHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHccccHHccccHHHHHHHHHcccccccccccccccccccccc //