[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67931.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->56 PF05757 * PsbQ 7.7e-05 40.0 35/203  
:HMM:PFM   41->82 PF05029 * TIMELESS_C 0.00046 33.3 42/565  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67931.1 GT:GENE BAC67931.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 258522..258809 GB:FROM 258522 GB:TO 258809 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67931.1 LENGTH 95 SQ:AASEQ MELLWQCPRRKTLVDWPEDVDTRLDVLVRAAAAAGEQTSRSQVLAALVTAAEVRPAVISELLHSYRQMQADALEADNTRADLPSVRSPGRTRGRR GT:EXON 1|1-95:0| SEG 30->34|aaaaa| HM:PFM:NREP 2 HM:PFM:REP 22->56|PF05757|7.7e-05|40.0|35/203|PsbQ| HM:PFM:REP 41->82|PF05029|0.00046|33.3|42/565|TIMELESS_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 85-95| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //