[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67932.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:351 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->121 PF03457 * HA 5.4e-17 40.3 62/68  
:HMM:PFM   124->186 PF03457 * HA 1.2e-06 30.5 59/68  
:HMM:PFM   198->265 PF03457 * HA 9.5e-13 35.3 68/68  
:PROS 120->126|PS00092|N6_MTASE
:REPEAT 2|65->131|208->275
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67932.1 GT:GENE BAC67932.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 260024..261079 GB:FROM 260024 GB:TO 261079 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:NOTE PF03457: Helicase associated domain GB:PROTEIN_ID BAC67932.1 LENGTH 351 SQ:AASEQ MRCGGCRRPISLRKWGRGCVSWLPPPLAFRLHAGSTGWRAELWLPRRVGQGAGLKAVSEERFQDGLGHARRYVARHGHLAVPHADAPQDGFDLGRWLANLRAASAGLPPEYVRVLAELDVWWNPPWPISWQRAWHRARAHALAHGPVSGGDNLAGLPRWLERWLRRQIAEYSQLAAEQQQLLAQLGLTPAEIDRFHAWPARRRSVMHGLEATHDYAASHGHLAVSQLTSHDGFALGKWLNQVRHRQRTATQPTRLGRQLTALDTWWNPPWPLDWQRYYWATRHHLHGLPEGVVWWPGAPEEAQTQQWLHEQQASWQHLHNEQKALVGRLATDQSTGGSPRSDRPDSSPLSS GT:EXON 1|1-351:0| PROS 120->126|PS00092|N6_MTASE|PDOC00087| NREPEAT 1 REPEAT 2|65->131|208->275| SEG 132->144|rawhrarahalah| SEG 173->187|qlaaeqqqllaqlgl| SEG 338->350|sprsdrpdsspls| HM:PFM:NREP 3 HM:PFM:REP 59->121|PF03457|5.4e-17|40.3|62/68|HA| HM:PFM:REP 124->186|PF03457|1.2e-06|30.5|59/68|HA| HM:PFM:REP 198->265|PF03457|9.5e-13|35.3|68/68|HA| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 102-107, 246-249, 336-351| PSIPRED ccccccccccHHHHHccHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccHHHccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccc //