Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67933.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:350 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67933.1 GT:GENE BAC67933.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 261139..262191 GB:FROM 261139 GB:TO 262191 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67933.1 LENGTH 350 SQ:AASEQ MPRGRPQDLAWRQFVRPAAVPEPVVLAAAYAARMTQEWTSAMSFSSFAPPSGGQDEAAPVDPREAVEAVAMRWQAFSSRGAQVGWASQESLRQAGVTGYGPLINRVVEIHGLMGSIGEQLALARAAEQDAQRHQRTAAIHDPRQAAVLEHSRRMAVRALCEMSTHFVLGAAHGLANLVLRTVLCHPAAAYEVNQAKRLKKAQGFPPGTDLKEAWLTFSPTGDVWSTLLPAAAEASGLTSLQDLVARLCLLQVDPRFSALEQRRGMDYHRHRPQSLDHTSPRAGLWSYDPVHKVSTMRMPGASADAERDEETVHRISADALECLGAALTDIEPLMGESLRSCHLSWIPVNA GT:EXON 1|1-350:0| SEG 17->32|paavpepvvlaaayaa| SEG 40->53|samsfssfappsgg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 48-59, 127-136, 199-200, 300-309| PSIPRED cccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHEEccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccc //