[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67936.2
DDBJ      :             putative IS701 family ISMmq4-like transposase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:421 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   135->413 1b7eA PDBj 6e-11 11.0 %
:RPS:SCOP  146->413 1b7eA  c.55.3.4 * 1e-10 9.9 %
:HMM:SCOP  8->410 1musA_ c.55.3.4 * 9.3e-31 24.4 %
:HMM:PFM   177->402 PF01609 * Transposase_11 7.8e-13 21.9 146/207  
:BLT:SWISS 39->235 T701_FREDI 2e-13 34.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67936.2 GT:GENE BAC67936.2 GT:PRODUCT putative IS701 family ISMmq4-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 266779..268044 GB:FROM 266779 GB:TO 268044 GB:DIRECTION + GB:PRODUCT putative IS701 family ISMmq4-like transposase GB:NOTE IS701 family (266715..268155) Inverted repeat sequence (16/18 bp). Target sequence (CTAG) GB:PROTEIN_ID BAC67936.2 LENGTH 421 SQ:AASEQ MTPEEMASVREDLEAFAAELFDGFFRADQRRWGQAYVRGLLLEGRRKSVEPMAARLGEDGNRQALAHFITSSPWDPAHVRARLAWRMQDAIGAEALIVDDTGFVKDGDASACVSRQYTGTAGKVTKCQVGVSLHLARDHASAAVNWRLFLPASWDPMSSEADPDKVARRTRCGVPDRVGHVEKWQLALDMIDETRSWGIDIPLVVADAGYGDATAFRHGLEERKLPYAVGISSRHTAHPADARPVQPAYAGSGRPPAMQYPEPAQTMKDLVTAAGRAAARAVSWREGSRPGKSVSGFKRMHSRFVALRVRPAGRGVRQSTDGPELPERWLLAEWPATEPEPVQFWLSNLPSGMPLATLVRLAKLRWRIEHDYREMKQALGLAHFEGRTWNGWHHHVTLVSAAHAFCTLQRLAQDPKDAAEE GT:EXON 1|1-421:0| BL:SWS:NREP 1 BL:SWS:REP 39->235|T701_FREDI|2e-13|34.5|177/380| SEG 273->281|aagraaara| RP:PDB:NREP 1 RP:PDB:REP 135->413|1b7eA|6e-11|11.0|246/372| HM:PFM:NREP 1 HM:PFM:REP 177->402|PF01609|7.8e-13|21.9|146/207|Transposase_11| RP:SCP:NREP 1 RP:SCP:REP 146->413|1b7eA|1e-10|9.9|233/372|c.55.3.4| HM:SCP:REP 8->410|1musA_|9.3e-31|24.4|357/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 589 OP:NHOMOORG 67 OP:PATTERN ----------------------------1-1--------------------2---------------- --1----2--1---1-----------------------91--4F----------------13----68131---------------------------------------------------------------------------N---1-U-----------2-1--3-------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A-----------4-13-------------------122---2--5--------1-----13-----1-------JIHIHHHH225-11--------------------------------------------------------2--------1--------7---1--61-----1----------------2-----------------------6------62------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-------------------------------------------------***--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 59.9 SQ:SECSTR ######################################################################################################################################EEEEEEEcccccEEEEEEEEETTTccEEEEEEEcccccGGGHHHHHHTHHHHHHHHHHHHHGGGGGGEEEEEEEcc#cHHHHHHHHHHHTcEEEEEEccccccTT###TcccHHHHHHTccccEEEEEEEc#######################cccccccEEEEEEEcEEEEEccTTccEEEEEEEEEccccEEEEccccccccEEEEEEccccccHHHHHHHHHHHHTcTHHHHHHHHHHHHHTTTcccccccHHHHHHHHHHHHHHHHHHHHHHHH######## DISOP:02AL 1-1,3-6,263-266,410-422| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccEEEEEccccEEEEccccccccccccccccccccccccHHHHHHHHHcccccccEEEEcccccccccccccccccccEEEEEEEEccccccEEccccccccEEEEEEEEcccccccHHHEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //