[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67937.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:397 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   91->201 2b0tA PDBj 2e-05 16.7 %
:RPS:SCOP  148->391 1b7eA  c.55.3.4 * 6e-07 14.2 %
:HMM:SCOP  75->390 1musA_ c.55.3.4 * 8.9e-08 21.7 %
:HMM:PFM   114->381 PF01609 * Transposase_11 1.4e-09 25.6 164/207  
:BLT:SWISS 7->137 LTAA_AERJA 3e-04 29.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67937.1 GT:GENE BAC67937.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 268251..269444 GB:FROM 268251 GB:TO 269444 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07643: Protein of unknown function (DUF1598) GB:PROTEIN_ID BAC67937.1 LENGTH 397 SQ:AASEQ MCSDQGTHTSSTKAVRMSLLHHDSRSEALAQLSCFRGEFYSCLTARSDALFELADAVLCGDGPVRSLAELSLVGEHRRGHGGLYAALARGRIDAGRLRRALAEVPLPRAADGRLVLAVDVTCWLRPDAHTSPQRILCHTYGRGKDQHIPVPGWPYSIVCALEPGRSSWTAPLDALRLTPGDDTATVTARQLRDLLQRLITAGQWQTGDPDILIVADAGYDAPRLGFLLRDLPVQVLARMRSDRVLRRAVPPRLPHTQGRPPRHGGEFVFGQPDTWDTPDTETVTDTRLYGQATARSWNRLHPKLTHRSSWAAADGTLPIVEGTVIRLDIAHLPSGATPKPVWLWWSGTDATPADADRLWQAYLRRFDIEHTFRLFKQTLGWTSPRSAPPRQPTGGPG GT:EXON 1|1-397:0| BL:SWS:NREP 1 BL:SWS:REP 7->137|LTAA_AERJA|3e-04|29.3|123/100| SEG 243->254|rvlrravpprlp| RP:PDB:NREP 1 RP:PDB:REP 91->201|2b0tA|2e-05|16.7|108/735| HM:PFM:NREP 1 HM:PFM:REP 114->381|PF01609|1.4e-09|25.6|164/207|Transposase_11| RP:SCP:NREP 1 RP:SCP:REP 148->391|1b7eA|6e-07|14.2|219/372|c.55.3.4| HM:SCP:REP 75->390|1musA_|8.9e-08|21.7|286/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 24 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------1--42-----------------2----14------------------------------------------------------------------------------53---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 91.9 SQ:SECSTR EEEccccccccTTcccccccTTcTTcTTcHHHHccccTHHHHHHHHHHHHTEEEEEEEcccccc#cHHHHTHHHHHTTccEEEcTTc#cHEEcTTcEEEEEEEcHHHHHHHHHHHHHHHHHHEEcccEEEEccTTcHHHHHHHHHHHHHHTTcccTTccEEEEcHHHHHHHEHHHHHHTTcccEEEEcHHHHHHHHHHHHHHHHGGGGGGEEEEEEEcccHHHHHHHHHHHTcEEEEEEccc########################cccTTTcccHHHHHHTccccEEEEEEEccccccccEEEEEEEcEEEEEccTTccEEEEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHTcTHHHHHHHHHHHHHTTTcccccccHH###### DISOP:02AL 1-10, 249-261, 386-397| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccEEEEcccHHHHHHHHHccccHHHHHHHHHHccccccccccEEEEEEcccccccccccccccEEEEccccccccccccccccEEEEEEEEcccccEEcccccEEccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHccHHHHHHHHHcEEEEccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHccccccccccEEEEEEEEcccccccccccEEEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccc //