Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67941.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67941.1 GT:GENE BAC67941.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(273444..273962) GB:FROM 273444 GB:TO 273962 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67941.1 LENGTH 172 SQ:AASEQ MSALDFYAHVAVCGEVRGVGLGAGPEAWEAALGATCLDVPGGGLLRRDYGLVEINFSPDQPGRQGQMSCFGFGVKIQRLLYDQSPNTVPSPLSREYGEFAPRVPFKQLQAAILALGRTIELDKHNTSSDMDCYRVSASAARIHVVADPDPYGSGDPDPDGHQRGDVWSVDVW GT:EXON 1|1-172:0| SEG 147->160|dpdpygsgdpdpdg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 154-158| PSIPRED ccHHHHHHHHHHHcccccccccccHHHHHHHHccEEEEcccccEEEccccEEEEEEcccccccccccEEEEcccEEEEEHHccccccccccHHHHHHHccccccHHHHHHHHHHHccEEEEcccccccccEEEEEEcccEEEEEEEcccccccccccccccccccEEEEEcc //