[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67942.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->78 3d5pA PDBj 4e-06 19.6 %
:HMM:PFM   25->76 PF09346 * SMI1_KNR4 7.3e-06 24.0 50/130  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67942.1 GT:GENE BAC67942.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(274210..274494) GB:FROM 274210 GB:TO 274494 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67942.1 LENGTH 94 SQ:AASEQ MGIGRRERMTSLLDTPYLVKEWELPSPIVLLSGDGHCWISLDYRACGPNGEPSVTWFDTDLDTELALASDFRMFVENLTAGSALGVDPGDSTSA GT:EXON 1|1-94:0| RP:PDB:NREP 1 RP:PDB:REP 20->78|3d5pA|4e-06|19.6|56/131| HM:PFM:NREP 1 HM:PFM:REP 25->76|PF09346|7.3e-06|24.0|50/130|SMI1_KNR4| OP:NHOMO 16 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------111111----1-111--112---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 59.6 SQ:SECSTR ###################THHHHccTTEEEEEETTEEEEEETT###TccEEEEETTcccGGGcEEEEccHHHHHHHH################ DISOP:02AL 1-9, 87-94| PSIPRED cccccccccccccccccEEEEccccccEEEEcccccEEEEEEcHHccccccccEEEEEccccEEEEEcccHHHHHHHHcccccccccccccccc //