[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67943.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->141 3ehjA PDBj 1e-05 16.5 %
:RPS:SCOP  29->158 1bxdA  d.122.1.3 * 5e-04 18.9 %
:HMM:SCOP  31->150 1l0oA_ d.122.1.3 * 1.9e-06 29.1 %
:HMM:PFM   62->143 PF02518 * HATPase_c 2.1e-07 27.2 81/111  
:BLT:SWISS 20->103 GLYA_CALMQ 8e-04 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67943.1 GT:GENE BAC67943.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(274689..275168) GB:FROM 274689 GB:TO 275168 GB:DIRECTION - GB:PRODUCT putative regulatory protein GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC67943.1 LENGTH 159 SQ:AASEQ MEAAPGSAGNVMPGADVIETAVALDGDGSCIAEARQLAVEFLTRVQSEYGVPVSARAMDLTQLVVSELVTNARKYAPGPVLMQLRLAGDLVEVVVWDSDPVLPVARAADPGRIGQHGLEIVMAISQEFEVQREPVGKRITARIALPDTPGADITGRRPQ GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 20->103|GLYA_CALMQ|8e-04|30.5|82/100| RP:PDB:NREP 1 RP:PDB:REP 33->141|3ehjA|1e-05|16.5|103/196| HM:PFM:NREP 1 HM:PFM:REP 62->143|PF02518|2.1e-07|27.2|81/111|HATPase_c| RP:SCP:NREP 1 RP:SCP:REP 29->158|1bxdA|5e-04|18.9|127/161|d.122.1.3| HM:SCP:REP 31->150|1l0oA_|1.9e-06|29.1|117/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 10 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------442----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 81.1 SQ:SECSTR ############################HHHHHHHHHHTTcEEcccccccccccHHHHHHHH#HHHHHHHHHHHHTcccEEEEEEEcccEEEEEEEEccccccccHHcTTcccHHHHHHHHHHTTcEEEEEccc#cEEEEEEEEEEccTTTcccccccc DISOP:02AL 1-12, 108-112, 154-155| PSIPRED ccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHEEEccccEEEEEEEEccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEEcccccccHHHHcccc //