[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67944.1
DDBJ      :             putative anti-sigma factor antagonist
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   54->160 1thnB PDBj 7e-10 29.9 %
:RPS:PDB   54->161 1auzA PDBj 2e-19 23.1 %
:RPS:SCOP  54->161 1th8B  c.13.2.1 * 4e-20 27.8 %
:HMM:SCOP  54->163 1h4xA_ c.13.2.1 * 2.8e-26 36.4 %
:RPS:PFM   60->145 PF01740 * STAS 1e-07 37.2 %
:HMM:PFM   57->159 PF01740 * STAS 4.7e-17 27.2 103/117  
:BLT:SWISS 54->161 SP2AA_PAEPO 1e-09 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67944.1 GT:GENE BAC67944.1 GT:PRODUCT putative anti-sigma factor antagonist GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 275233..275721 GB:FROM 275233 GB:TO 275721 GB:DIRECTION + GB:PRODUCT putative anti-sigma factor antagonist GB:NOTE PF01740: STAS domain GB:PROTEIN_ID BAC67944.1 LENGTH 162 SQ:AASEQ MRARCWRKDCIGVPRQGTGAGWVRTRCARIRDPQSASPVEEVVTDTHEAARPGLSIDHQAVDGIRIVVLRGEIDHANRDSLHEALLIPEGEAEPRTVADFRGVTFMDSSGINVLITAHRAAQDAGGWLRLAGVQEPVQRVLALVGIDTLIPCHSTLEEALTS GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 54->161|SP2AA_PAEPO|1e-09|30.8|107/117| BL:PDB:NREP 1 BL:PDB:REP 54->160|1thnB|7e-10|29.9|107/114| RP:PDB:NREP 1 RP:PDB:REP 54->161|1auzA|2e-19|23.1|108/116| RP:PFM:NREP 1 RP:PFM:REP 60->145|PF01740|1e-07|37.2|86/107|STAS| HM:PFM:NREP 1 HM:PFM:REP 57->159|PF01740|4.7e-17|27.2|103/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 54->161|1th8B|4e-20|27.8|108/115|c.13.2.1| HM:SCP:REP 54->163|1h4xA_|2.8e-26|36.4|110/111|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 26 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------1---1---1-------------4311-------1-------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------111-11-------------------1---------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 66.7 SQ:SECSTR #####################################################ccccEEEETTEEEEcccccccTTHHHHHHHHHHHHHccccccEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGGGTcccccGGGTGG# DISOP:02AL 1-3| PSIPRED cccEEEEcccEEEcccccHHHHHHHcccEEEEcccccHHHHHHHHHHHccccccEEEEEEEccEEEEEEEcEEEHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcHHHEEcccccHHHHHcc //