[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67947.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->80 PF07228 * SpoIIE 7e-04 35.5 %
:HMM:PFM   2->131 PF07228 * SpoIIE 3.5e-28 36.0 125/193  
:BLT:SWISS 2->86 Y1364_MYCTU 2e-09 41.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67947.1 GT:GENE BAC67947.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 278037..278444 GB:FROM 278037 GB:TO 278444 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:NOTE PF07228: Stage II sporulation protein E (SpoIIE) GB:PROTEIN_ID BAC67947.1 LENGTH 135 SQ:AASEQ MATMILATLTLGDDELWQLRWTNAGHPPPLLVSHDGRARYLTDAHGILLGTGTIRPRPDVFTVLPPRTTVLLYTDGLVESPHHSIDHGLERLRRHAASLAHRPLDSFCDLLLERVRPSDNDDDVAMLALRTPTRA GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 2->86|Y1364_MYCTU|2e-09|41.8|79/100| SEG 89->104|lerlrrhaaslahrpl| RP:PFM:NREP 1 RP:PFM:REP 2->80|PF07228|7e-04|35.5|76/193|SpoIIE| HM:PFM:NREP 1 HM:PFM:REP 2->131|PF07228|3.5e-28|36.0|125/193|SpoIIE| GO:PFM:NREP 1 GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| OP:NHOMO 46 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----1----------22----2--1-------21111----1--C-------------------31-4623---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 134-135| PSIPRED cEEEEEEEEEEccccccEEEEEEccccccEEEccccEEEEEccccccEEEccccccccEEEEEEccccEEEEEEccEEEcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEEEccccc //