[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67948.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   102->136 PF06651 * DUF1163 8e-04 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67948.1 GT:GENE BAC67948.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(278470..279057) GB:FROM 278470 GB:TO 279057 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67948.1 LENGTH 195 SQ:AASEQ MQGHRSNYVRPHCYCAACMGLGLRIGAFGPAVDEEGNTVPGSRAVYPWSALPAVIGGDVDRDERPFAWFTHFLEAAGPVVVDEGDGENLWPRGIQHDDALFCETGVTGEFGLADGVAATQFQPGAGRTALHLGRHPVEQLLPSWDHRVLRFPGQIGAVEVEDVVVLKDHFCCSSVPSHTLPGDGHAQEVRTGDRA GT:EXON 1|1-195:0| RP:PFM:NREP 1 RP:PFM:REP 102->136|PF06651|8e-04|40.0|35/69|DUF1163| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 188-195| PSIPRED cccccccccccccHHHHHHccEEEEEcccccccccccccccccEEccHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEcccccccccccccccccEEEcccccccccccccccccEEcccccccEEHHccccHHHHcccccccEEEcccccccEEEcEEEEEEccccccccccccccccccHHHHcccccc //