[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67949.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67949.1 GT:GENE BAC67949.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(279267..279635) GB:FROM 279267 GB:TO 279635 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67949.1 LENGTH 122 SQ:AASEQ MHIVLDDTAMAAAGQGNVLASRLIHRAHAESGWFLYAPACALVEADRARPGTAEHLASLPGITVLDLDLAAALAVARQKTWAAAHSQYAAQPTPERPDGAIIATTAPNRWKGEPVRVLDLTP GT:EXON 1|1-122:0| SEG 64->76|vldldlaaalava| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------111-----------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEccHHHHHHccccHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHccHHHHHHHcccEEEEEccHHHHHHHHHHccHHHHHHHHHccccccccccEEEEEEccHHHccccccEEcccc //