[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67950.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->53 1mntA_ a.43.1.1 * 2.5e-05 36.0 %
:HMM:PFM   11->45 PF01402 * RHH_1 1.6e-06 31.4 35/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67950.1 GT:GENE BAC67950.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(279644..279919) GB:FROM 279644 GB:TO 279919 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03869: Arc-like DNA binding domain GB:PROTEIN_ID BAC67950.1 LENGTH 91 SQ:AASEQ MGRSTMMSDANVRIPEEAKERLAAIAAAEGLSLRAYLARLAETLLTPAERAERAEKALAALKEWNGYAPTAAEEQDLDSVLDRRLAQATGR GT:EXON 1|1-91:0| SEG 16->35|eeakerlaaiaaaeglslra| SEG 48->63|aeraeraekalaalke| HM:PFM:NREP 1 HM:PFM:REP 11->45|PF01402|1.6e-06|31.4|35/39|RHH_1| HM:SCP:REP 4->53|1mntA_|2.5e-05|36.0|50/0|a.43.1.1|1/1|Ribbon-helix-helix| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 88-91| PSIPRED cccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccc //