[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   93->108 PF07597 * DUF1560 0.00099 43.8 16/49  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67951.1 GT:GENE BAC67951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(280342..280782) GB:FROM 280342 GB:TO 280782 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67951.1 LENGTH 146 SQ:AASEQ MGVRTAYKFNRSAARAVAAASLAWRTVRAPAGVNRRAPTPPISVISGPKTTDVDGSVARLAIVPAPNTPDLPSEHSPDGAGTGRVRFPLVQWVLAPRTTWQARRLAADFGEGMDARTAWVMARLARHPDERDYAMAHLDDERRIAD GT:EXON 1|1-146:0| SEG 11->23|rsaaravaaasla| HM:PFM:NREP 1 HM:PFM:REP 93->108|PF07597|0.00099|43.8|16/49|DUF1560| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 71-80, 144-146| PSIPRED ccccccHHHcHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccccEEEEEEEEccccccccccccccccccccEEHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccEEEEEccccccccc //