[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67953.1
DDBJ      :             putative MerR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->101 3d70A PDBj 8e-08 20.2 %
:RPS:SCOP  18->79 1j9iA  a.6.1.5 * 3e-06 8.1 %
:HMM:SCOP  17->105 1jbgA_ a.6.1.3 * 1e-08 25.8 %
:HMM:PFM   19->55 PF00376 * MerR 3.5e-08 45.9 37/38  
:HMM:PFM   60->93 PF08615 * RNase_H2_suC 0.00046 29.4 34/137  
:BLT:SWISS 13->89 HSPR_STRCO 5e-05 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67953.1 GT:GENE BAC67953.1 GT:PRODUCT putative MerR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 281928..282242 GB:FROM 281928 GB:TO 282242 GB:DIRECTION + GB:PRODUCT putative MerR-family transcriptional regulator GB:NOTE PF00376: MerR family regulatory protein GB:PROTEIN_ID BAC67953.1 LENGTH 104 SQ:AASEQ MTADDSHNRLEDDDYPAYTMGRAAELLGTTQGFLRAIGDARLITPLRSPGGHRRYSRYQLRIAARARELVGHGTPIEAACRIIILEDQLEEAQRTNAEYRRTAE GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 13->89|HSPR_STRCO|5e-05|32.5|77/151| RP:PDB:NREP 1 RP:PDB:REP 18->101|3d70A|8e-08|20.2|84/276| HM:PFM:NREP 2 HM:PFM:REP 19->55|PF00376|3.5e-08|45.9|37/38|MerR| HM:PFM:REP 60->93|PF08615|0.00046|29.4|34/137|RNase_H2_suC| RP:SCP:NREP 1 RP:SCP:REP 18->79|1j9iA|3e-06|8.1|62/68|a.6.1.5| HM:SCP:REP 17->105|1jbgA_|1e-08|25.8|89/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 17 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----2--------------------------------13--1----------------------112321----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 80.8 SQ:SECSTR #################EEHHHHHHHHTccHHHHHHHHHTTccccccTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTHHHHHHHHHHHHHHHHHH### DISOP:02AL 1-7, 96-104| PSIPRED cccccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHccc //