[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67955.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  138/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->65 2ordA PDBj 2e-06 33.3 %
:RPS:PDB   13->75 2bhgA PDBj 1e-08 11.3 %
:RPS:SCOP  13->75 1d7rA  c.67.1.4 * 1e-06 22.6 %
:HMM:SCOP  9->75 1qj5A_ c.67.1.4 * 3.1e-10 43.3 %
:RPS:PFM   14->74 PF00202 * Aminotran_3 5e-06 45.8 %
:HMM:PFM   13->75 PF00202 * Aminotran_3 3.3e-10 30.6 62/339  
:BLT:SWISS 9->75 ECTB_STRCO 3e-25 73.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67955.1 GT:GENE BAC67955.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(283694..284041) GB:FROM 283694 GB:TO 284041 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67955.1 LENGTH 115 SQ:AASEQ MVGVENGPRGPVFFSFEPAGIVPDIVCLSKSISGYGMPMALTLLRPEYDVWKPGEHNGAFRGYNPAFLTGARALEGAALRPCGRGPARCAMRRTGEACCWRRPGPTTRWPRSCRR GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 9->75|ECTB_STRCO|3e-25|73.1|67/423| SEG 100->111|wrrpgpttrwpr| BL:PDB:NREP 1 BL:PDB:REP 4->65|2ordA|2e-06|33.3|60/384| RP:PDB:NREP 1 RP:PDB:REP 13->75|2bhgA|1e-08|11.3|62/184| RP:PFM:NREP 1 RP:PFM:REP 14->74|PF00202|5e-06|45.8|59/336|Aminotran_3| HM:PFM:NREP 1 HM:PFM:REP 13->75|PF00202|3.3e-10|30.6|62/339|Aminotran_3| GO:PFM:NREP 2 GO:PFM GO:0008483|"GO:transaminase activity"|PF00202|IPR005814| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF00202|IPR005814| RP:SCP:NREP 1 RP:SCP:REP 13->75|1d7rA|1e-06|22.6|62/431|c.67.1.4| HM:SCP:REP 9->75|1qj5A_|3.1e-10|43.3|67/429|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 171 OP:NHOMOORG 142 OP:PATTERN -------------------------11---1--------------1---------------------- --------------1------1---1------11112111-1-1--22-1----------1---2113121-------------------------------------------------------------------------1-1----------------1--11--------------------------11111----1-1---12111--1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------------------------1--------1----1---1---------1---------1----------------------------------------1-111-1-------1111---111111------1-----1--1--------11-----1---------------1-1-------------------------1-----------------------1---------12----1----------------------111----------2---------------------------------------2-------------------------1---------------------------11121111-111111111-----------12121212131211111221--------211111222222211-----------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 79.1 SQ:SECSTR ##ccccGGGcTTEcccEEccccTTEEEEEccccTTTcTTcEEEEEETTEEEEEEEEEEEETTEEEEEEccHHHHHHHHHTTTcTTcHHHHHHH###################### DISOP:02AL 114-115| PSIPRED ccccccccccccEEEEEccccEEEEEEEEcHHHccccEEEEEEEcHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHcHHHccc //