[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67957.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->92 PF06707 * DUF1194 0.00039 13.2 38/206  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67957.1 GT:GENE BAC67957.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(287461..287775) GB:FROM 287461 GB:TO 287775 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67957.1 LENGTH 104 SQ:AASEQ MATENCRRDLTAICKAADSGYLLQVVRDDGFEPLAEKHLSHWPDWPTFPVDAAHAAGCELIMLGYVIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQVQAAGI GT:EXON 1|1-104:0| TM:NTM 1 TM:REGION 55->77| HM:PFM:NREP 1 HM:PFM:REP 55->92|PF06707|0.00039|13.2|38/206|DUF1194| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHccccccccccccccccccEEEEEEEEEcccccccccccccccccccccHHcccccHHHEEEccc //