[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67958.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->61 PF07332 * DUF1469 3.1e-05 32.1 53/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67958.1 GT:GENE BAC67958.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(288173..288562) GB:FROM 288173 GB:TO 288562 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67958.1 LENGTH 129 SQ:AASEQ MPGPKVTAAVGAVLSAATAVVTNLVTTRWSPALIAAAVVLVIAGAAAAAASAAHGRSDSPPTARLTARRRGHLDRIRVAHGADAAVRIEATGSAAEVSNLEVNIDNAEAIAKATGRGTISNSSIVQRNS GT:EXON 1|1-129:0| TM:NTM 2 TM:REGION 5->27| TM:REGION 30->51| SEG 6->27|vtaavgavlsaatavvtnlvtt| SEG 32->53|aliaaavvlviagaaaaaasaa| HM:PFM:NREP 1 HM:PFM:REP 9->61|PF07332|3.1e-05|32.1|53/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 51-63, 127-129| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccHHHEEEEccccEEEEEEEccccccccEEEEEcccHHHHHHHccccccccccEEEccc //