[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67960.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  124/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.35.1
:251 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  113->214 1iwgA7  f.35.1.1 * 7e-05 16.8 %
:HMM:SCOP  1->215 1iwgA7 f.35.1.1 * 2.4e-22 21.4 %
:RPS:PFM   67->214 PF03176 * MMPL 2e-11 37.0 %
:HMM:PFM   8->221 PF03176 * MMPL 1.2e-33 27.0 204/333  
:BLT:SWISS 8->233 MMPL3_MYCLE 9e-36 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67960.1 GT:GENE BAC67960.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(292968..293723) GB:FROM 292968 GB:TO 293723 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:NOTE PF02355: Protein export membrane protein GB:PROTEIN_ID BAC67960.1 LENGTH 251 SQ:AASEQ MTPKSDAAQSLVGDVRALTPPPGTHPLVGGIDAELVDAKHSISGQIPLAIGLVVVTTFVLLFLFTGSVVQPLRALALNAITLVATLGIMTRIFQDGHLSSLLGFTAQPMEMSMTVLMFCIVFGLSMDYEVFVTSRIKELHAPGEDTESAVTNGLGHTGRIVTAAACLLAVSFFAFGTAKLSFMQMFGLGSGLAILIDAVAIRGVLVPAAMRLLGDSAWYAPGFLRRFHGRFGLSESAPESAAEPEPAVSRG GT:EXON 1|1-251:0| BL:SWS:NREP 1 BL:SWS:REP 8->233|MMPL3_MYCLE|9e-36|40.3|226/955| TM:NTM 5 TM:REGION 36->58| TM:REGION 71->93| TM:REGION 110->132| TM:REGION 152->174| TM:REGION 186->208| SEG 52->65|lvvvttfvllflft| SEG 234->247|sesapesaaepepa| RP:PFM:NREP 1 RP:PFM:REP 67->214|PF03176|2e-11|37.0|138/284|MMPL| HM:PFM:NREP 1 HM:PFM:REP 8->221|PF03176|1.2e-33|27.0|204/333|MMPL| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF03176|IPR004869| RP:SCP:NREP 1 RP:SCP:REP 113->214|1iwgA7|7e-05|16.8|101/199|f.35.1.1| HM:SCP:REP 1->215|1iwgA7|2.4e-22|21.4|196/200|f.35.1.1|1/1|Multidrug efflux transporter AcrB transmembrane domain| OP:NHOMO 395 OP:NHOMOORG 140 OP:PATTERN ------1111211111-11--11--------------------------------------------- ----B234333413E6755-5A2267545553899A7967165D31211221322111--23614228B71-----------1----------------------------------------------------------111-1-------------------------------------111-----1-1222221222222222--11-1222---2-111-1111-1-111111111111111-112---------------------1---------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------1-----------------------------------------------------------------------------------------------------5------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 230-251| PSIPRED cccccHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc //