[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67961.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  905/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.137.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->183 2hydA PDBj 6e-25 38.2 %
:RPS:PDB   4->183 3b5jA PDBj 3e-29 36.4 %
:RPS:SCOP  1->46 1ckvA  d.137.1.1 * 7e-04 4.3 %
:RPS:SCOP  67->158 1e69A  c.37.1.12 * 6e-25 27.0 %
:HMM:SCOP  1->168 1pf4A1 c.37.1.12 * 1.8e-41 38.8 %
:RPS:PFM   20->113 PF00005 * ABC_tran 9e-10 42.7 %
:RPS:PFM   85->152 PF02463 * SMC_N 4e-07 41.2 %
:HMM:PFM   15->113 PF00005 * ABC_tran 2.1e-18 35.3 85/118  
:HMM:PFM   84->155 PF02463 * SMC_N 4e-07 36.1 72/220  
:BLT:SWISS 8->183 MSBA_RALSO 2e-31 43.9 %
:PROS 85->99|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67961.1 GT:GENE BAC67961.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 294014..294610 GB:FROM 294014 GB:TO 294610 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC67961.1 LENGTH 198 SQ:AASEQ MEWDQVDLATADPQSVWKSVAMVPQDYTRWPLTCRENITLGMPSDEGDAAVLRAAEEAGAMAVVAHLPDGLDTSLARSWWGGHDLSGGQWQRIALARAFHKDAPVLILDEPTSALDARIEHQVFSRLRELSAGRTALFITHRLANARVADKVIVLEKGAVAESGTYDELLRIDGLFAELHRMQEGAERDIPTPRTTRI GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 8->183|MSBA_RALSO|2e-31|43.9|173/592| PROS 85->99|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 49->65|aavlraaeeagamavva| BL:PDB:NREP 1 BL:PDB:REP 15->183|2hydA|6e-25|38.2|165/578| RP:PDB:NREP 1 RP:PDB:REP 4->183|3b5jA|3e-29|36.4|176/243| RP:PFM:NREP 2 RP:PFM:REP 20->113|PF00005|9e-10|42.7|89/123|ABC_tran| RP:PFM:REP 85->152|PF02463|4e-07|41.2|68/536|SMC_N| HM:PFM:NREP 2 HM:PFM:REP 15->113|PF00005|2.1e-18|35.3|85/118|ABC_tran| HM:PFM:REP 84->155|PF02463|4e-07|36.1|72/220|SMC_N| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 2 RP:SCP:REP 1->46|1ckvA|7e-04|4.3|46/141|d.137.1.1| RP:SCP:REP 67->158|1e69A|6e-25|27.0|89/263|c.37.1.12| HM:SCP:REP 1->168|1pf4A1|1.8e-41|38.8|165/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 22161 OP:NHOMOORG 1170 OP:PATTERN CC73854587865778E6876564NAAJG8H851212342421969CF53NEB2ADB6448A72A112 A9I7rIIEKKMEFEBEFBB-BI55GcBBBBBBNKJKMfUa5SEbOYUNMHF9WaXCEQ44NSBFYERpklGJHGGPHGLElLJ54644AC74-735A--53C78AF6GBC122222224233337DC8BHCAID7DJLMRO543T6OHJNFFFA9BBGBDBE7EBFJUcfG6FA8987D7876BAC77PJ5HFOWXZWZVgbUZcaWXeeRXXVRabfIEKabNLPQRPQM*pIIIIIIHIIIIIIIHGBACDbNEIRTJEJCLQPCCUTKEBGNLNOOMOQUPNOSXVOTRPOLQSMQQFHGFGGHHJHGFGVNLMMLNMNLLTMUWTTTSVURDUFNNQQDMJLfEHUSWOJ93stOE7CDHA9IIKIBDFE5988889BA9AB5liqECIMMIQFWaVXaUYQSV*-KKpJJcIWn*96******v*****pX488QYufUbgVXgBBBBBBBBICG9CBFZ33233333444644674565464465374364734RnhSaWXZYaYNPQQPTTcnVSUUFRVRnOOVM35KKLJLLKGMIePh*CJE5D6BMD4455655A67DE7BCR5GELJADKFEI7BBBC68C9A78A6JSAH684957777655466666664B43788SRI5B69367R9DDDD98EBAAC9CDDDDE3-87DB5221222aPpfHXSRUUSRSRTPP-URQQRMQQRRUSTNOQNNPelilkOPMPPOOPPPPPPPOPOOPdONNPPPQG4XZZXbbZXaZbZ228456445ABDB63VKZEEDEJICGGEECBBJ9BB9B6C79GHHJLOKSdXaMVWOQDief6765586574IRQYRRRRQZWXYYDFB9A999893333228CBB4444-111111-q1N87558-4665DB5CBC67C654667EELBCNTONL4A9 4611NKD-QB54KLJGEJDJMQNaJZMFFCDCDMLLCIIGIGFCCBLKKUSNaRHIMFIEFFEBA5872974CAC892777866C969-RcCEIOKDDEGB9EIKB4DnX*SaRgVlIHFILPHYZFqD**a1iQjHJFBWELqSFIHEETFA*GQKMVHc*GeMFFgJQ*aaiW7CAA*677GDbYY*Fko9GpXbcJ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 100.0 SQ:SECSTR HHETTEETTTccHHHHHHHEEEEccccccTTccHHHHHcTTcTcTccHHHHHHHHHHHTcHHHHHTcTTGGGccccTccTTTTcccHHHHHHHHHHHHHTTcccEEEEccccccccHHHHHHHHHHHHHHHTTcEEEEEcccGGGGTTccEEEEEETTEEEEEEcHHHHHcTTcHHHHHHHHHccccccccccEEEEE DISOP:02AL 182-198| PSIPRED cEEcccccccccHHHHHHHccccccccEEEHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHHHHccccccccccc //