[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67966.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  829/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
b.161.1c.37.1
:198 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   22->109 1ji0A PDBj 8e-13 37.5 %
:RPS:PDB   11->109 1e9sG PDBj 1e-19 13.3 %
:RPS:SCOP  13->92 1q3hA  c.37.1.12 * 1e-16 15.0 %
:RPS:SCOP  81->114 2f9hA1  b.161.1.1 * 5e-05 11.8 %
:HMM:SCOP  6->131 1htwA_ c.37.1.18 * 1.1e-24 35.2 %
:RPS:PFM   52->106 PF00005 * ABC_tran 8e-04 38.5 %
:HMM:PFM   52->110 PF00005 * ABC_tran 1.3e-07 31.0 58/118  
:HMM:PFM   28->68 PF03193 * DUF258 8.6e-05 25.0 40/161  
:BLT:SWISS 7->121 DRRA_STRPE 2e-23 48.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67966.1 GT:GENE BAC67966.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(299873..300469) GB:FROM 299873 GB:TO 300469 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC67966.1 LENGTH 198 SQ:AASEQ MTPADPTSPPGTIVTRGLRRTYGDVEAVQGLDLTVAQGELFAFLGPNGAGKSTTIGMLCTTLRPTTGHAQVAGADITRSPHDVRRQIGVVFQESTTDDDLTAQENLRLYADLYGIYLYSARLLSVLGCPCLPLVCRHTPNDIDSHFARSDVPVSCSYALNLSESQAAGDGPAGRVGGIVMDLDAVDAQGRVVQVMCPG GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 7->121|DRRA_STRPE|2e-23|48.7|115/330| BL:PDB:NREP 1 BL:PDB:REP 22->109|1ji0A|8e-13|37.5|88/231| RP:PDB:NREP 1 RP:PDB:REP 11->109|1e9sG|1e-19|13.3|98/427| RP:PFM:NREP 1 RP:PFM:REP 52->106|PF00005|8e-04|38.5|52/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 52->110|PF00005|1.3e-07|31.0|58/118|ABC_tran| HM:PFM:REP 28->68|PF03193|8.6e-05|25.0|40/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 13->92|1q3hA|1e-16|15.0|80/265|c.37.1.12| RP:SCP:REP 81->114|2f9hA1|5e-05|11.8|34/121|b.161.1.1| HM:SCP:REP 6->131|1htwA_|1.1e-24|35.2|122/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 8131 OP:NHOMOORG 1038 OP:PATTERN 8762446676778776H4878888L9CFBHAD32421-323227I3DA77F9839D88E8A2328-12 7AN7p44888726364366-6922BH666668EDCDMSLK8PERCSDE8963EFC285--NOP6NGKfdbA333372237C5H1-2222231-2114--244234B37631111111---1111153252244255EFFFF665IJ9578659AB884443427879BAB5152212151221FEFB875287CHHJIJJLMEIKJKKHBDCC9BIIL9CGA9ACB99989NK3233333333332343111352456452123664488632312234555331588855565766666333333334433383422243448E6J9FFFGGEH3F74DGG8332I7833R4564KJ74A88679958831287IEDD9-----78eVa648KJKHHBDBDBCEBCAS-99V76OCGJT82TTTPTRWbZZWWSK247EAUDFIIJAE55555555F5634ADI-----------------------------244323BQLCLGFHKJG7C9A9LLPNDDDDBGLEXIJMJ24EEDG9DADNELNMf984554454---11117549C449B752683546671566695859EJKFGF7C221221111111111111111121-64765333626233656524555567544666---3752------B5874637777787766-7766777685766677778BBB133444345454555555554576566552-544565544565--14233234445B38A52223121-1-1-1121122121122839A89797797B749877222121222223252333355355574444544423231154442366111122117-5-------1--121--------1---3A654899774B6 ----A83-HA146B42132---1--1111----2111111111111212212221-211---1---------------------------21111-------1----455C9CAF8A6384797MN4E7Q*D1D8I5622F55C859457E42i7D75D49T3754468AP88A53362Z1113276781C621FCECA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 138-145| PSIPRED cccccccccccEEEEEEEEEEEccEEEEEcccEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHcHHHccHHHHHHHHHHcccEEEEEcccEEEEEcccccccHHHHHHHHHHHcccEEEEEEcc //