[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67967.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->83 PF05402 * PqqD 1.7e-07 29.6 54/81  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67967.1 GT:GENE BAC67967.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(300882..301145) GB:FROM 300882 GB:TO 301145 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67967.1 LENGTH 87 SQ:AASEQ MMNFALAPEVSVTDTEHGTVLLDERTGRYWLLNGTGALALRALLDGTSPQGVVASLCQRFPDAGTAQVEQDVDNLLHALRTAKVAAS GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 28->83|PF05402|1.7e-07|29.6|54/81|PqqD| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--2--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 85-87| PSIPRED ccccccccccccccccccEEEEEcccccEEEEcccHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccc //