[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67970.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->54 PF08019 * DUF1705 0.00054 25.0 32/156  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67970.1 GT:GENE BAC67970.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 304104..304334 GB:FROM 304104 GB:TO 304334 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67970.1 LENGTH 76 SQ:AASEQ MLGQGQYVPLDLMIEGESQRMSERDALRGLRALMWVVIAIEVPVYLVWLVEVSYLTGQQLPRGTEEEDGKPRADTD GT:EXON 1|1-76:0| TM:NTM 1 TM:REGION 32->54| HM:PFM:NREP 1 HM:PFM:REP 23->54|PF08019|0.00054|25.0|32/156|DUF1705| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 17-25, 59-76| PSIPRED ccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //