[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67974.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.63.1
:137 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->112 2fblB PDBj 6e-07 47.3 %
:RPS:SCOP  33->117 2fblA1  d.63.1.2 * 8e-20 31.8 %
:HMM:SCOP  2->123 2fblA1 d.63.1.2 * 2.9e-13 36.6 %
:BLT:SWISS 16->94 DNAE2_RHOBA 2e-04 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67974.1 GT:GENE BAC67974.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 309794..310207 GB:FROM 309794 GB:TO 310207 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67974.1 LENGTH 137 SQ:AASEQ MGTRLRLRRADFSDGRCERKLTQKVPVSRPGGVQGLITNTYLSPTEYDLLASLPAAVLSKTRFSVPPLGVDVFDGPLQGLVLAEAEFTTDEETQSFIPPSECVAEVTDDARFTGGRLVETSRQELLGWLAEYGLRPQ GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 16->94|DNAE2_RHOBA|2e-04|37.0|73/100| BL:PDB:NREP 1 BL:PDB:REP 58->112|2fblB|6e-07|47.3|55/148| RP:SCP:NREP 1 RP:SCP:REP 33->117|2fblA1|8e-20|31.8|85/144|d.63.1.2| HM:SCP:REP 2->123|2fblA1|2.9e-13|36.6|112/0|d.63.1.2|1/1|CYTH-like phosphatases| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 40.1 SQ:SECSTR #########################################################EEEEEEEEETTcEEEEcGGGTTcEEEEEEEccTTHHHHccccTTEEEEcTTcGGG######################### DISOP:02AL 1-6| PSIPRED cccccccccEEEEEcccEEEEEEEcccccHHHHHHHHHHHccccHHHHHHHcccccEEEEEEEEccccccEEEcccccccEEEEEEcccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccc //