[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67976.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:116 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67976.1 GT:GENE BAC67976.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 311330..311680 GB:FROM 311330 GB:TO 311680 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67976.1 LENGTH 116 SQ:AASEQ MLEDPAAHGVDLDCTMVLHELTGDEWPATRAHAEEFVLPHLREHRVRLVQVARASRSLEITVIDDSRQPQRIVERGPWALWDEYESGGTVPQQGGIRLCSLHAKGNWRMPLSPTTC GT:EXON 1|1-116:0| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------11------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 115-116| PSIPRED cccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcEEEEEEEccccEEEEEEEEccccccEEEEEcccHHHHHHHHcccccccccEEEEEEEccccEEcccccccc //