[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67977.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   29->76 PF08777 * RRM_3 0.0007 22.9 48/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67977.1 GT:GENE BAC67977.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(312030..312479) GB:FROM 312030 GB:TO 312479 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67977.1 LENGTH 149 SQ:AASEQ MQSAGDVGYEHAQVGEEYWAGLPLPWNESGKDIQITRAKFTHVPKGLKVIEYRAFNGDDTDGNVLFARTDGKGSVGDLFKARNYAGHPMTVKAKTGSHVYYVARVKVTGPIHDNLSGCSYWYRQGSTEFQQQLDCSTIVRLGKPLKYEG GT:EXON 1|1-149:0| HM:PFM:NREP 1 HM:PFM:REP 29->76|PF08777|0.0007|22.9|48/105|RRM_3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 60.4 SQ:SECSTR #######################################cHHHHHHHTcccEEEGGGTEETTEEEEEccccHHHHHHHHHHHHHTTccEEEccccEEHHHHHHTTTcccccccTT######HHHHccccEEEEcc############## DISOP:02AL 1-6, 147-149| PSIPRED cccccccccHHHHHHHHHHccccccccccccEEEEEEEEEcccccccEEEEEEEcccccccccEEEEEEcccccHHHHHHHcccccccEEEEEccccEEEEEEEEEEEcccccccccHHHHHHcccHHHHHHccHHHHHHccccccccc //