[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67979.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->122 PF05257 * CHAP 0.00021 22.0 41/125  
:HMM:PFM   137->159 PF04153 * NOT2_3_5 0.00024 39.1 23/131  
:HMM:PFM   20->77 PF09867 * DUF2094 0.00033 22.4 58/138  
:BLT:SWISS 82->167 YGL4_BACST 8e-05 39.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67979.1 GT:GENE BAC67979.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 315325..315852 GB:FROM 315325 GB:TO 315852 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67979.1 LENGTH 175 SQ:AASEQ MRPWRPWSCPYDDLMRQADPKPYWNTNVARHPGILRAVPKTGTASATAAQPLLDYINRRYPLTQTTPLDANRFRANAVPEAEPGDIIAYDWQNDGEVDHLSLVVDIADGQYPEIAEWGVVDWNPLGVINRNATTPYAKRGWTYSEKNHNWLQSVEETRNVSAKLIHIDTRNVTTF GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 82->167|YGL4_BACST|8e-05|39.1|64/301| HM:PFM:NREP 3 HM:PFM:REP 79->122|PF05257|0.00021|22.0|41/125|CHAP| HM:PFM:REP 137->159|PF04153|0.00024|39.1|23/131|NOT2_3_5| HM:PFM:REP 20->77|PF09867|0.00033|22.4|58/138|DUF2094| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-40,45-46,48-48,53-53,59-59,67-67,81-82,87-88,90-90,95-95,157-157,175-176| PSIPRED ccccccccccHHHHHHHcccccccccccccccccEEEcccccccccHHHHHHHHHHHccccccccccccHHHcccccccccccccEEEEEccccccEEEEEEEEEEcccccccHHccccccccccEEEEccccccHHHcccEEcccccHHHHHHHHHccccEEEEEEEccccccc //