[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67982.1
DDBJ      :             putative DNA invertase/recombinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.74.1
:114 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  24->79 1c9bA2  a.74.1.2 * 1e-04 28.6 %
:HMM:SCOP  35->86 1hcrA_ a.4.1.2 * 0.00064 23.1 %
:HMM:PFM   43->74 PF01527 * Transposase_8 1.7e-06 34.4 32/76  
:BLT:SWISS 11->80 RES2_CLOPE 1e-08 39.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67982.1 GT:GENE BAC67982.1 GT:PRODUCT putative DNA invertase/recombinase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 320615..320959 GB:FROM 320615 GB:TO 320959 GB:DIRECTION + GB:PRODUCT putative DNA invertase/recombinase GB:NOTE PF02796: Helix-turn-helix domain of resolvase GB:PROTEIN_ID BAC67982.1 LENGTH 114 SQ:AASEQ MGQTLAAAGGLQRDLQRELTYDGLRAAEAKGSKGGRRPAVAAAKAETVRTAYLEGRSIAALARDHGVSRGAIRTAIADLQHLGEMEWIGPVGQGLFGATDGGRPSQAAAHAGLV GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 11->80|RES2_CLOPE|1e-08|39.1|69/189| HM:PFM:NREP 1 HM:PFM:REP 43->74|PF01527|1.7e-06|34.4|32/76|Transposase_8| RP:SCP:NREP 1 RP:SCP:REP 24->79|1c9bA2|1e-04|28.6|56/109|a.74.1.2| HM:SCP:REP 35->86|1hcrA_|0.00064|23.1|52/52|a.4.1.2|1/1|Homeodomain-like| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 23-41, 108-109| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccc //